HORDB

ID: hor002621
Uniprot ID: O01970
Protein name: NLP-12
Gene name: nlp-12
Organism: Caenorhabditis elegans
Family: NA
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0031739 cholecystokinin receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0060756 foraging behavior
GO CC: GO:0005615 extracellular space; GO:0043005 neuron projection; GO:0043025 neuronal cell body

Sequence: DYRPLQF
Length: 7
Propeptide: MLRHHSCALLMLILVFVEVFATQSPTFDRQDRDYRPLQFGKRDGYRPLQFGKRDYRPLQFGKRSSGSSGPVVLEPIWEWQ
Signal peptide: MLRHHSCALLMLILVFVEVFA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002621_AF2.pdb

hor002621_ESM.pdb

Mass:	104525	Formula:	C44H63N11O12
Absent amino acids:	ACEGHIKMNSTVW	Common amino acids:	DFLPQRY
pI:	6.34	Basic residues:	1
Polar residues:	1	Hydrophobic residues:	2
Hydrophobicity:	-111.43	Boman Index:	-2142
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	55.71
Instability Index:	4772.86	Extinction Coefficient cystines:	1490
Absorbance 280nm:	248.33

PubMed ID: 20013198
Title: Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans